Ailuropoda melanoleuca (giant panda): 100466871 Help Entry 100466871         CDS       T01329                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04015   Rap1 signaling pathway aml04810   Regulation of actin cytoskeleton aml05014   Amyotrophic lateral sclerosis aml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100466871 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100466871 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100466871 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100466871 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100466871 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aml04812]     100466871 (PFN1)    04147 Exosome [BR:aml04147]     100466871 (PFN1) Membrane trafficking [BR:aml04131]  Others   Actin-binding proteins    Others     100466871 (PFN1) Cytoskeleton proteins [BR:aml04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100466871 (PFN1) Exosome [BR:aml04147]  Exosomal proteins   Proteins found in most exosomes    100466871 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100466871 NCBI-ProteinID:  XP_034503013 Ensembl:  ENSAMEG00000029462 LinkDB All DBs Position 17:1642710..1645353 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaacgttc gtcaacatcacgccagctgaggttggtgtccttgttggcaaagaccggtcaagttttttc gtgaacgggctgacacttgggggccagaaatgttctgttatccgggattcactgctgcag gacggggagtttaccatggatcttcgtaccaagagcaccggtggcgctcccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system