Ailuropoda melanoleuca (giant panda): 100467125 Help Entry 100467125         CDS       T01329                                  Name (RefSeq) histone H2B type 1-J   KO K11252   histone H2B Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04613   Neutrophil extracellular trap formation aml05034   Alcoholism aml05203   Viral carcinogenesis aml05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100467125  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100467125   09163 Immune disease    05322 Systemic lupus erythematosus     100467125   09165 Substance dependence    05034 Alcoholism     100467125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100467125   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100467125 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100467125 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100467125 SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  100467125 NCBI-ProteinID:  XP_002930272 UniProt:  D2I4V3 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIF NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcccgagcccgcaaagtccgctcccgcgcccaagaagggctccaagaaagcggtcacc aaagcccagaagaaggacggcaagaagcgcaagcgcagccgtaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttc

DBGET integrated database retrieval system