Ailuropoda melanoleuca (giant panda): 100467200 Help Entry 100467200         CDS       T01329                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml02010   ABC transporters aml05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     100467200 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     100467200 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:aml02000]     100467200 (DEFB1)    03037 Cilium and associated proteins [BR:aml03037]     100467200 (DEFB1) Transporters [BR:aml02000]  Other transporters   Pores ion channels [TC:1]    100467200 (DEFB1) Cilium and associated proteins [BR:aml03037]  Motile cilia and associated proteins   Sperm associated proteins    100467200 (DEFB1) SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Defb50 Motif Other DBs NCBI-GeneID:  100467200 NCBI-ProteinID:  XP_002929992 LinkDB All DBs Position 18 Genome browser AA seq 68 aa AA seqDB search MRILSFLLILGVLFSHLAPGAGYLTGFGQRSDHYVCARRGGTCNFSPCPLFTRVDGTCYG GKAKCCMR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaggattctctccttcctgctgattctgggcgtgctcttctcccacctggccccaggt gctggctaccttacaggtttcggccagaggtcagaccactacgtctgtgccaggagagga ggcacctgtaacttttccccgtgcccgctcttcaccagggtggacggcacctgttacggc gggaaggccaagtgctgcatgcgttga

DBGET integrated database retrieval system