Ailuropoda melanoleuca (giant panda): 100467568 Help Entry 100467568         CDS       T01329                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04014   Ras signaling pathway aml04015   Rap1 signaling pathway aml04024   cAMP signaling pathway aml04072   Phospholipase D signaling pathway aml04137   Mitophagy - animal aml04140   Autophagy - animal aml04218   Cellular senescence aml04360   Axon guidance aml04371   Apelin signaling pathway aml04625   C-type lectin receptor signaling pathway aml04810   Regulation of actin cytoskeleton aml05132   Salmonella infection aml05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100467568 (RRAS)    04014 Ras signaling pathway     100467568 (RRAS)    04015 Rap1 signaling pathway     100467568 (RRAS)    04371 Apelin signaling pathway     100467568 (RRAS)    04072 Phospholipase D signaling pathway     100467568 (RRAS)    04024 cAMP signaling pathway     100467568 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100467568 (RRAS)    04137 Mitophagy - animal     100467568 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     100467568 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100467568 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100467568 (RRAS)   09158 Development and regeneration    04360 Axon guidance     100467568 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100467568 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100467568 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:aml04031]     100467568 (RRAS) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100467568 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Abhydrolase_4 Motif Other DBs NCBI-GeneID:  100467568 NCBI-ProteinID:  XP_019653692 Ensembl:  ENSAMEG00000013931 UniProt:  G1M5S0 LinkDB All DBs Position 12:30540268..30544197 Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccaggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcattcagtcctactttgtgtctgactacgacccc accatcgaagactcctatacgaagatctgcactgtggatggtgtcccagcccggctggac atcctggatacagcaggccaggaggagttcggtgccatgcgggagcagtacatgcgtgct ggccacggctttctgctggtgtttgccattaatgaccggcagagtttcaatgaggtgggc aagcttttcacgcagatcctccgagtcaaggaccgagatgattttcccatcgtgttggtt gggaacaaggcagatctggagacacagcgccaggtgccccgatctgaagcctctgccttt ggcgcctcccaccatgtggcctacttcgaggcctcggccaaattgcgcctcaatgtggat gaggccttcgagcagctggtgcgggccgtcaggaagtatcaagaacaagagctgccgccc agcccacccagtgcccccaggaagaaagacggaggctgtccctgcgtcctcctgtag

DBGET integrated database retrieval system