Ailuropoda melanoleuca (giant panda): 100467683 Help Entry 100467683         CDS       T01329                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04020   Calcium signaling pathway aml04022   cGMP-PKG signaling pathway aml04114   Oocyte meiosis aml04218   Cellular senescence aml04310   Wnt signaling pathway aml04360   Axon guidance aml04370   VEGF signaling pathway aml04380   Osteoclast differentiation aml04625   C-type lectin receptor signaling pathway aml04650   Natural killer cell mediated cytotoxicity aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04662   B cell receptor signaling pathway aml04720   Long-term potentiation aml04724   Glutamatergic synapse aml04921   Oxytocin signaling pathway aml04922   Glucagon signaling pathway aml04924   Renin secretion aml05010   Alzheimer disease aml05014   Amyotrophic lateral sclerosis aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05031   Amphetamine addiction aml05152   Tuberculosis aml05163   Human cytomegalovirus infection aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05170   Human immunodeficiency virus 1 infection aml05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100467683 (PPP3R1)    04310 Wnt signaling pathway     100467683 (PPP3R1)    04370 VEGF signaling pathway     100467683 (PPP3R1)    04020 Calcium signaling pathway     100467683 (PPP3R1)    04022 cGMP-PKG signaling pathway     100467683 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100467683 (PPP3R1)    04218 Cellular senescence     100467683 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100467683 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     100467683 (PPP3R1)    04660 T cell receptor signaling pathway     100467683 (PPP3R1)    04658 Th1 and Th2 cell differentiation     100467683 (PPP3R1)    04659 Th17 cell differentiation     100467683 (PPP3R1)    04662 B cell receptor signaling pathway     100467683 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     100467683 (PPP3R1)    04921 Oxytocin signaling pathway     100467683 (PPP3R1)    04924 Renin secretion     100467683 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     100467683 (PPP3R1)    04720 Long-term potentiation     100467683 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     100467683 (PPP3R1)    04380 Osteoclast differentiation     100467683 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100467683 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100467683 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     100467683 (PPP3R1)    05163 Human cytomegalovirus infection     100467683 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     100467683 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     100467683 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     100467683 (PPP3R1)    05014 Amyotrophic lateral sclerosis     100467683 (PPP3R1)    05020 Prion disease     100467683 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     100467683 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     100467683 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100467683 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aml01009]     100467683 (PPP3R1) Protein phosphatases and associated proteins [BR:aml01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100467683 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  100467683 NCBI-ProteinID:  XP_034515126 Ensembl:  ENSAMEG00000027372 UniProt:  A0A7N5P1U7 LinkDB All DBs Position 4:complement(91205529..91276909) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgacttggacaattcgggatctttgagtgtg gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat atatttgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system