Ailuropoda melanoleuca (giant panda): 100467789 Help Entry 100467789         CDS       T01329                                  Name (RefSeq) metallothionein-1-like   KO K14739   metallothionein 1/2 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04978   Mineral absorption Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100467789  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aml03019]     100467789    03029 Mitochondrial biogenesis [BR:aml03029]     100467789 Messenger RNA biogenesis [BR:aml03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100467789 Mitochondrial biogenesis [BR:aml03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100467789 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100467789 NCBI-ProteinID:  XP_002912297 Ensembl:  ENSAMEG00000031439 UniProt:  A0A7N5KF74 LinkDB All DBs Position 12:54508259..54509875 Genome browser AA seq 61 aa AA seqDB search MDPNCSCSTGGSCTCAGSCKCKECKCTSCKKSCCSCCPAGCAKCAQGCVCKEASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgctccaccggtggctcctgcacgtgtgccggttcctgcaaa tgcaaggagtgcaagtgcacctcctgcaagaagagctgctgctcctgctgccccgcgggc tgtgccaagtgtgcccagggctgtgtctgcaaggaggcatcggacaagtgcagctgctgt gcgtga

DBGET integrated database retrieval system