Ailuropoda melanoleuca (giant panda): 100468878 Help Entry 100468878         CDS       T01329                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04613   Neutrophil extracellular trap formation aml05034   Alcoholism aml05203   Viral carcinogenesis aml05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100468878  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100468878   09163 Immune disease    05322 Systemic lupus erythematosus     100468878   09165 Substance dependence    05034 Alcoholism     100468878  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100468878   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100468878 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100468878 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100468878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100468878 NCBI-ProteinID:  XP_002928601 UniProt:  D2HWJ0 LinkDB All DBs Position 5:complement(2012012..2012460) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggcgaagtccgctccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aaatacaccagttccaagtaa

DBGET integrated database retrieval system