Ailuropoda melanoleuca (giant panda): 100468964 Help Entry 100468964         CDS       T01329                                  Symbol ELOC Name (RefSeq) elongin-C   KO K03872   elongin-C Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04066   HIF-1 signaling pathway aml04120   Ubiquitin mediated proteolysis aml05170   Human immunodeficiency virus 1 infection aml05200   Pathways in cancer aml05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:aml00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100468964 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100468964 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100468964 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     100468964 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100468964 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aml04121]     100468964 (ELOC)    03400 DNA repair and recombination proteins [BR:aml03400]     100468964 (ELOC) Ubiquitin system [BR:aml04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100468964 (ELOC)    Cul5 complex      100468964 (ELOC) DNA repair and recombination proteins [BR:aml03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100468964 (ELOC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  100468964 NCBI-ProteinID:  XP_034524101 Ensembl:  ENSAMEG00000012854 UniProt:  G1M2H4 LinkDB All DBs Position 9:complement(46077139..46102453) Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacctatggtggctgtgaaggccctgatgccatgtatgtcaaa ttgatatcttcggatggtcatgaatttattgtaaaaagagaacatgcactaacatccgga acaataaaagccatgttgagtggcccaggtcagtttgctgagaacgaaactaatgaagtc aattttagagagatcccttcacatgtgctatcaaaagtatgcatgtattttacctacaag gttcgctacactaacagctccacagagattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system