Ailuropoda melanoleuca (giant panda): 100469007 Help Entry 100469007         CDS       T01329                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04014   Ras signaling pathway aml04137   Mitophagy - animal aml04144   Endocytosis aml04145   Phagocytosis aml04148   Efferocytosis aml04962   Vasopressin-regulated water reabsorption aml05132   Salmonella infection aml05146   Amoebiasis aml05152   Tuberculosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100469007 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100469007 (RAB5C)    04145 Phagocytosis     100469007 (RAB5C)    04137 Mitophagy - animal     100469007 (RAB5C)    04148 Efferocytosis     100469007 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100469007 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100469007 (RAB5C)    05152 Tuberculosis     100469007 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     100469007 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100469007 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100469007 (RAB5C)    04031 GTP-binding proteins [BR:aml04031]     100469007 (RAB5C) Membrane trafficking [BR:aml04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100469007 (RAB5C)  Endosome - Lysosome transport     100469007 (RAB5C) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100469007 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    100469007 (RAB5C)   Exosomal proteins of colorectal cancer cells    100469007 (RAB5C)   Exosomal proteins of bladder cancer cells    100469007 (RAB5C) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100469007 (RAB5C) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  100469007 NCBI-ProteinID:  XP_019658273 Ensembl:  ENSAMEG00000006003 UniProt:  D2HIT1 LinkDB All DBs Position 13 Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPSRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcgcgacccaatggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtctgcggtaggcaaatctagcctcgtcctccgc ttcgtcaagggacagttccatgagtaccaggagagcacaattggagcggccttcctcaca cagacagtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tatgacatcaccaatacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggccagccccaacatcgtcatcgcgctcgcggggaacaaggcggacctggccagc aagagagctgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc atggagacatcggcaaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaatgagccccagaatgcagctggtgctccgagccggaaccgaggtgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system