Ailuropoda melanoleuca (giant panda): 100470125 Help Entry 100470125         CDS       T01329                                  Name (RefSeq) tubulin beta-2 chain   KO K07375   tubulin beta Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04145   Phagosome aml04540   Gap junction aml04814   Motor proteins aml05010   Alzheimer disease aml05012   Parkinson disease aml05014   Amyotrophic lateral sclerosis aml05016   Huntington disease aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aml00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100470125   09144 Cellular community - eukaryotes    04540 Gap junction     100470125   09142 Cell motility    04814 Motor proteins     100470125  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100470125   09164 Neurodegenerative disease    05010 Alzheimer disease     100470125    05012 Parkinson disease     100470125    05014 Amyotrophic lateral sclerosis     100470125    05016 Huntington disease     100470125    05020 Prion disease     100470125    05022 Pathways of neurodegeneration - multiple diseases     100470125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100470125   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aml04812]     100470125    04147 Exosome [BR:aml04147]     100470125 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      100470125 Cytoskeleton proteins [BR:aml04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     100470125 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100470125   Exosomal proteins of colorectal cancer cells    100470125   Exosomal proteins of bladder cancer cells    100470125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tubulin Tubulin_2 Tubulin_3 Motif Other DBs NCBI-GeneID:  100470125 NCBI-ProteinID:  XP_034509293 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search FWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSG PFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSL GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDET YCIDNEALYDICFRTLKLTTPTYG NT seq 613 nt NT seq  +upstreamnt  +downstreamnt ttctgggaggtcatcagtgatgagcatggaatcgaccccactggcagttaccatggagac agtgatttgcagctggagagaatcaatgtgtactacaatgaagccactggtaacaaatac gtacctcgggctatcctggtggatctggagccgggcaccatggactccgtcaggtctgga ccatttggccagattttcaggccggacaacttcgtatttggccagagtggtgcaggaaac aactgggcaaagggccactacactgagggagccgaactggtggactcggtcctggacgtg gtgaggaaggagtcagaaagctgtgactgtctgcagggcttccagctgacccactcgctg gggggcggcacggggtccggcatgggcaccctgctcatcagcaagatccgggaggagtac ccagaccgcatcatgaacaccttcagcgtcatgccctcgcccaaggtgtccgacacggtg gtcgagccctacaacgccaccctgtccgtgcaccagctggtggagaacacggatgaaacc tactgcatcgacaacgaagccctgtacgacatctgcttccgcaccctgaaactgaccacg cccacgtacggag

DBGET integrated database retrieval system