Ailuropoda melanoleuca (giant panda): 100470232 Help Entry 100470232         CDS       T01329                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04062   Chemokine signaling pathway aml04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100470232 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     100470232 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100470232 (CCL22)    04062 Chemokine signaling pathway     100470232 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100470232 (CCL22) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Chemokines    100470232 (CCL22) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100470232 NCBI-ProteinID:  XP_034528199 LinkDB All DBs Position 12 Genome browser AA seq 93 aa AA seqDB search MASLKTPLLAALVFLALILQATEAGPYGANVEDSICCREYFRHPLPLRMLKFFYWTSDSC RRPGVVFLTVKDREICADPRMPWVKKILQKLDQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagactccgctcctggctgcccttgtcttccttgctctgatacttcaa gcaactgaggcaggtccttacggcgccaacgtggaggacagcatctgctgccgggaatac ttccgtcaccctctgcccctgcgcatgctgaagtttttctactggacctcggactcgtgc cggcggcccggcgtggtcttcctaactgtcaaggaccgggagatctgtgctgaccccaga atgccctgggttaagaagattctccagaaactggaccaatga

DBGET integrated database retrieval system