Ailuropoda melanoleuca (giant panda): 100471070 Help Entry 100471070         CDS       T01329                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04613   Neutrophil extracellular trap formation aml05034   Alcoholism aml05202   Transcriptional misregulation in cancer aml05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100471070  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100471070   09163 Immune disease    05322 Systemic lupus erythematosus     100471070   09165 Substance dependence    05034 Alcoholism     100471070  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100471070   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100471070 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100471070 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100471070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  100471070 NCBI-ProteinID:  XP_019649311 Ensembl:  ENSAMEG00000026075 UniProt:  D2I755 LinkDB All DBs Position 2:complement(87162564..87163037) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacgaagcagaccgcccgcaagtcgaccggtgggaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagtgcgccggccacgggcggcgtgaagaagccgcac cgctaccggccgggcaccgtggccctgcgcgagatccggcgctaccagaagtccacggag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagctcggcggtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaggacacgaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggctcgccgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system