Ailuropoda melanoleuca (giant panda): 100471245 Help Entry 100471245         CDS       T01329                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04140   Autophagy - animal aml04144   Endocytosis aml04152   AMPK signaling pathway aml04530   Tight junction aml04972   Pancreatic secretion aml05014   Amyotrophic lateral sclerosis aml05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     100471245 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100471245 (RAB8A)    04140 Autophagy - animal     100471245 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     100471245 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     100471245 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100471245 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     100471245 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100471245 (RAB8A)    03036 Chromosome and associated proteins [BR:aml03036]     100471245 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100471245 (RAB8A)    04031 GTP-binding proteins [BR:aml04031]     100471245 (RAB8A) Membrane trafficking [BR:aml04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     100471245 (RAB8A)  Autophagy   Other autophagy associated proteins     100471245 (RAB8A) Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100471245 (RAB8A) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100471245 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    100471245 (RAB8A)   Exosomal proteins of colorectal cancer cells    100471245 (RAB8A) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     100471245 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 AAA_7 Motif Other DBs NCBI-GeneID:  100471245 NCBI-ProteinID:  XP_002912748 Ensembl:  ENSAMEG00000009836 UniProt:  D2GUY4 LinkDB All DBs Position 4:11747320..11766045 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGKKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactcaactttcatctccacc ataggaattgactttaaaattcggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcaccacagcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaacatccgg aactggattcggaacattgaggagcatgcttctgcagatgtcgaaaagatgatactcggg aataagtgtgatgtgaacgacaagagacaagtttccaaggaacggggaaaaaagctggcc ctggactacggaatcaagttcatggagaccagtgcgaaggccaacatcaatgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agtccccaagggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system