Ailuropoda melanoleuca (giant panda): 100472573 Help Entry 100472573         CDS       T01329                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04015   Rap1 signaling pathway aml04810   Regulation of actin cytoskeleton aml05014   Amyotrophic lateral sclerosis aml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100472573 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100472573 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100472573 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100472573 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100472573 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aml04812]     100472573 (PFN4)    04147 Exosome [BR:aml04147]     100472573 (PFN4) Membrane trafficking [BR:aml04131]  Others   Actin-binding proteins    Others     100472573 (PFN4) Cytoskeleton proteins [BR:aml04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100472573 (PFN4) Exosome [BR:aml04147]  Exosomal proteins   Proteins found in most exosomes    100472573 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100472573 NCBI-ProteinID:  XP_002913843 Ensembl:  ENSAMEG00000002778 UniProt:  G1L7Q0 LinkDB All DBs Position 4:125900572..125915977 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSIMPGDVRTLVNGFAKNPLQTR REGLYFKEKDYKCIRADDYSLYAKNENTGVIVVKTHMYLLVATYTEGMYPSVCVEATEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatctgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaagaacgaagcttgtgtgtagcatcaccaggatttagtata atgcctggtgatgtccgaacacttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggattgtatttcaaggaaaaggactacaaatgtatccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtgattgttgtgaagacccatatgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaagctg ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system