Ailuropoda melanoleuca (giant panda): 100473242 Help Entry 100473242         CDS       T01329                                  Name (RefSeq) interleukin-3   KO K04736   interleukin 3 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04151   PI3K-Akt signaling pathway aml04210   Apoptosis aml04630   JAK-STAT signaling pathway aml04640   Hematopoietic cell lineage aml04664   Fc epsilon RI signaling pathway aml05200   Pathways in cancer aml05202   Transcriptional misregulation in cancer aml05221   Acute myeloid leukemia aml05310   Asthma Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100473242    04151 PI3K-Akt signaling pathway     100473242   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100473242  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100473242  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100473242    04664 Fc epsilon RI signaling pathway     100473242  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100473242    05202 Transcriptional misregulation in cancer     100473242   09162 Cancer: specific types    05221 Acute myeloid leukemia     100473242   09163 Immune disease    05310 Asthma     100473242  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100473242    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100473242 Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interleukins    100473242 Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Cytokines    100473242 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL3 CSTF2_hinge Motif Other DBs NCBI-GeneID:  100473242 NCBI-ProteinID:  XP_011222366 LinkDB All DBs Position 3:21148662..21150543 Genome browser AA seq 142 aa AA seqDB search MNSLPILHVLLLLLGLRAPMAQGRSLSTYQPKQYFEMISEIMDILNNSPSPSEETLDPNE TSTLLNTTLLRPNLEAFLNATKNFYNSESLIWKNLKEFLPLLPTPTPRGQPISIENNLGD FQKKLKKYLEALDNFLNFKNKQ NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgaacagcctccccatcctgcacgttctcctgctcctgcttggactccgagccccaatg gcacaggggcgctccttgtccacataccagcctaagcaatacttcgagatgatcagtgaa attatggacatcttaaacaattcaccctcgccttcagaagaaaccttggacccaaatgag acaagcaccctgctgaacactacccttctgaggccaaacctggaagcattcttgaatgct accaaaaatttctacaacagtgaatcgctaatctggaaaaatcttaaggaattcctgcca ctcctgcccactcccacacccaggggacaaccaatctctattgagaataacttgggtgat tttcaaaagaagctgaaaaagtatctggaagcccttgacaactttctgaatttcaagaac aagcaatga

DBGET integrated database retrieval system