Ailuropoda melanoleuca (giant panda): 100473739 Help Entry 100473739         CDS       T01329                                  Symbol FGF9 Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04014   Ras signaling pathway aml04015   Rap1 signaling pathway aml04020   Calcium signaling pathway aml04151   PI3K-Akt signaling pathway aml04810   Regulation of actin cytoskeleton aml05200   Pathways in cancer aml05207   Chemical carcinogenesis - receptor activation aml05218   Melanoma aml05224   Breast cancer aml05226   Gastric cancer Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100473739 (FGF9)    04014 Ras signaling pathway     100473739 (FGF9)    04015 Rap1 signaling pathway     100473739 (FGF9)    04020 Calcium signaling pathway     100473739 (FGF9)    04151 PI3K-Akt signaling pathway     100473739 (FGF9)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100473739 (FGF9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100473739 (FGF9)    05207 Chemical carcinogenesis - receptor activation     100473739 (FGF9)   09162 Cancer: specific types    05226 Gastric cancer     100473739 (FGF9)    05218 Melanoma     100473739 (FGF9)    05224 Breast cancer     100473739 (FGF9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100473739 (FGF9)    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100473739 (FGF9) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Growth factors (RTK binding)    100473739 (FGF9) Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Growth factors/receptors    100473739 (FGF9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100473739 NCBI-ProteinID:  XP_002928971 Ensembl:  ENSAMEG00000030186 UniProt:  D2I195 LinkDB All DBs Position 7:63637560..63667843 Genome browser AA seq 208 aa AA seqDB search MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR HQKFTHFLPRPVDPDKVPELYKDILSQS NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccatttggg aatgtgcccgtgttgccggtggacagtccggttttgttaagtgaccacctgggtcagtcc gaagcaggggggcttcccaggggacccgcagtcacggacttggatcatttaaaggggatt ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttt gaagaaaactggtataacacgtactcctcgaatctatataaacacgtggacactggaagg cgatactatgttgcattaaataaagacgggaccccaagagaaggaacgaggactaaacgg caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaacta tataaggatattctaagccaaagttga

DBGET integrated database retrieval system