Ailuropoda melanoleuca (giant panda): 100474600 Help Entry 100474600         CDS       T01329                                  Name (RefSeq) C-C motif chemokine 7   KO K05509   C-C motif chemokine 7 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04062   Chemokine signaling pathway aml04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100474600    04061 Viral protein interaction with cytokine and cytokine receptor     100474600  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     100474600    04062 Chemokine signaling pathway     100474600  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100474600 Cytokines and neuropeptides [BR:aml04052]  Cytokines   Chemokines    100474600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100474600 NCBI-ProteinID:  XP_002912401 Ensembl:  ENSAMEG00000028962 UniProt:  A0A7N5JJT7 LinkDB All DBs Position 13:8587034..8589082 Genome browser AA seq 99 aa AA seqDB search MNVSTALLCLLLTAMAFSLQVLAQPDGISISTTCCYGFTAKKIPTQKLKSYRRITSSYCP REAVIFKTKLAKEVCADPKQKWVRNLMEYLDKKTQTPKL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaatgtctccaccgcacttctctgcctgctgcttacagccatggccttcagcctccag gtgctcgcccagccagacgggattagcatctcgaccacctgctgctatggatttaccgct aagaagatccccacgcagaagctgaagagctacagaagaatcaccagcagctattgtccc agggaagccgtgatcttcaagaccaaactggccaaggaggtctgtgctgaccccaagcag aagtgggtccggaatctcatggagtacctggacaagaaaacccaaaccccaaagctgtga

DBGET integrated database retrieval system