Ailuropoda melanoleuca (giant panda): 100474742 Help Entry 100474742         CDS       T01329                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04020   Calcium signaling pathway aml04022   cGMP-PKG signaling pathway aml04114   Oocyte meiosis aml04218   Cellular senescence aml04310   Wnt signaling pathway aml04360   Axon guidance aml04370   VEGF signaling pathway aml04380   Osteoclast differentiation aml04625   C-type lectin receptor signaling pathway aml04650   Natural killer cell mediated cytotoxicity aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04662   B cell receptor signaling pathway aml04720   Long-term potentiation aml04724   Glutamatergic synapse aml04921   Oxytocin signaling pathway aml04922   Glucagon signaling pathway aml04924   Renin secretion aml05010   Alzheimer disease aml05014   Amyotrophic lateral sclerosis aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05031   Amphetamine addiction aml05152   Tuberculosis aml05163   Human cytomegalovirus infection aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05170   Human immunodeficiency virus 1 infection aml05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100474742 (PPP3R2)    04022 cGMP-PKG signaling pathway     100474742 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100474742 (PPP3R2)    04660 T cell receptor signaling pathway     100474742 (PPP3R2)    04658 Th1 and Th2 cell differentiation     100474742 (PPP3R2)    04659 Th17 cell differentiation     100474742 (PPP3R2)    04662 B cell receptor signaling pathway     100474742 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     100474742 (PPP3R2)    04921 Oxytocin signaling pathway     100474742 (PPP3R2)    04924 Renin secretion     100474742 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     100474742 (PPP3R2)    04720 Long-term potentiation     100474742 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     100474742 (PPP3R2)    04380 Osteoclast differentiation     100474742 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100474742 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100474742 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     100474742 (PPP3R2)    05163 Human cytomegalovirus infection     100474742 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     100474742 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     100474742 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     100474742 (PPP3R2)    05014 Amyotrophic lateral sclerosis     100474742 (PPP3R2)    05020 Prion disease     100474742 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     100474742 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     100474742 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100474742 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aml01009]     100474742 (PPP3R2) Protein phosphatases and associated proteins [BR:aml01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100474742 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 DUF6967 Motif Other DBs NCBI-GeneID:  100474742 NCBI-ProteinID:  XP_002926512 LinkDB All DBs Position 7:complement(31301578..31302403) Genome browser AA seq 170 aa AA seqDB search MGNEASYPEEMCSHFNSDEIKRLGKRFKKLDLDSSGALSMEEFMSLPELQQNPLVQRVVD VFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFSIYDIDKDGYISNGELFQVLKLMV GNNLKDWQLQQLVDKTIIILDRDGDGKISFEEFCAVVGGLEIHKKLVVVV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggagatgtgctcccacttcaactctgatgaaatc aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggcgcgctgagcatg gaggagttcatgtccctgcccgagctgcagcagaacccattggtgcagcgagtggtcgac gtcttcgacaccgatggcaacggagaagtggacttcaaggagttcatcctggggacctcc cagttcagtgtcaggggggacgaggagcaaaagttgaggtttgccttcagcatctacgac attgataaagacggctacatttccaacggggagctcttccaggtgctgaagctgatggtg ggcaacaacctgaaggactggcagctgcagcagctcgtggacaaaaccatcatcatcctg gatcgggatggagacggcaaaatatccttcgaggaattctgtgctgtggttggaggcctg gagatccacaagaagttggtggtggtagtgtga

DBGET integrated database retrieval system