KEGG   Ailuropoda melanoleuca (giant panda): 100475083
Entry
100475083         CDS       T01329                                 
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04610  Complement and coagulation cascades
aml04810  Regulation of actin cytoskeleton
aml05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100475083
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100475083
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100475083
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:aml04515]
    100475083
   04090 CD molecules [BR:aml04090]
    100475083
Cell adhesion molecules [BR:aml04515]
 Integrins
  Integrin alpha subunits
   100475083
CD molecules [BR:aml04090]
 Proteins
  100475083
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 100475083
NCBI-ProteinID: XP_002924795
LinkDB
Position
10:complement(15592021..15642413)
AA seq 1166 aa
MSDLPVMTGTRSPLLLLMGLASSLCFNLDTDQPKTFLMDSAGFGHSVVQYGNTWVVVGAP
QEIKAANQTGGLYQCDYSTGKCEPIRLQVPPEAVNMSLGLSLAASTNPSQLLACGPTLHH
TCRENVYLSGFCFLLGFPSWQAQRLPAALQECPRQEQDIVFLIDGSGSISPLDFTKMLNF
VKAVMSQFRRPNTQFSLMQFSDDFRVHFTFKDFTDSSNPLVLLDSVYQLGGYTHTATAIQ
MVTNQLFSTSSGARKDASKILIVITDGQKQGDYLNYEDVIPMAEAAGIIRYAVGVGLAFR
KRHSWKELNDIASKPSNEYIFKVDNFDVLRDIQNQLKEKIFAIEGTQTSSSSSFELEMSQ
EGFSAVFTPDGPVLGAVGSFGWSGGAFLYPPNKSPTFINMSQENVDMRDSYLGYSTELAF
WKGAQSLILGAPRHQHTGKAVIFTQTSGQWRPKAEVAGTQIGSYFGASLLAVDVDRDGSS
DLVLIGAPHYYKPSQGGQVSVCPFPQGRAKWQCAVILCGEQGHPWGRFGAALTVLGDVNG
DKLTDAAIGAPGEEESRGAVYLFHGTSRPGISPSHSQRISASQLSPRLQYFGQSLSGGQD
LTLDGLVDLAVGAQGQVLLLRTRPVLRVWMSVRFKPSEIARSLFECRKETSSVNTLGDAD
VCLHIDESPKNRLGNLQSSVTFDLTLDPGRQNPRAIFEETKTWNLTRVRDLGLRQHCETV
KLLLLACVEDTVTPITLRLNFSLVGKPIPSFGNLRPMLAVDAQRYYTASLPFEKNCGTDH
VCQDDLGISFGFSGLETLLVGSTLELNMKVMVWNDGEDSYGTTVTLFYPPGLSYRRVAEI
KNQLQPHSPRLTCDGVPAQGQSTQSTRCSINHLILQEGSQITFLVTFDVSPKAVLGDRLL
LTANVSSENNTPRTNKSTFQLELMVKYAIYTVISSHEQSTKYLNFSASDQKKSSQAQHRY
RVNNLGQRDLPISIIFSVPVELNGVPVWTDLEVFHPQNPSIQCSSERIVHTESDFLKHIQ
KNSLLNCSIADCLRYQCDFPSFGIQEELDFVLKGNLSFGWVSQTSQKKVLVVSVAEITFN
RSVYSQLPGQEAFLRAQIETVLEKYEVYNPLPIIVGSSVGGLLLLALITAILYKVGFFKR
QYKEMMAEASGQTVPEDGTSGPQVAQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtctgaccttccagtcatgactgggaccagatcacccctcctcctgttgatgggcttg
gcttcttctctctgcttcaacttggacacggaccagccaaaaaccttccttatggacagt
gctggatttggacacagtgtggtccagtatggcaacacctgggtggtggttggagccccc
caggagataaaggctgccaaccaaacaggcggcctctaccagtgtgactacagcacgggc
aagtgtgagcccatccgcctgcaggtccccccggaagctgtgaacatgtccctgggcctg
tccctggcagcctccacgaacccctctcagctgttggcctgtggccccacactgcaccat
acatgcagggagaacgtgtacttgtctgggttctgcttcctgctgggcttcccttcctgg
caagcccagaggctcccggctgccctgcaggagtgtccgaggcaagagcaggatatcgtg
ttcctgatcgacggctcaggcagcatctccccccttgattttaccaagatgttgaatttc
gtgaaggctgtgatgagccagttccggagacctaacacccagttctccctgatgcagttt
tccgacgatttccgggtgcacttcactttcaaagacttcaccgacagctccaacccgcta
gttctgctggattctgtgtatcagctgggaggatacactcacacagccacagccatccaa
atggtcacaaaccaactgttcagtacctcaagtggggcccgaaaagatgcctccaagatc
ctcattgtcatcaccgatgggcaaaaacaaggcgactacctgaattatgaggatgtcatc
cctatggctgaggctgcgggtatcatccgctatgcagttggggtgggattggcttttcga
aagagacattcctggaaagaattaaatgacattgcatcgaagccctccaatgagtacatt
tttaaagtggacaattttgatgttttgagagacatacaaaaccaactaaaagagaagatc
tttgccattgagggtacgcagacctcaagcagtagttcctttgaattggagatgtcccag
gagggcttcagcgctgtgttcacacctgatggaccagttctgggggctgtggggagcttc
ggctggtccggaggtgccttcctgtaccccccaaacaagagccccactttcatcaacatg
tctcaagagaatgtggacatgagggactcttacctgggttactccactgagctggccttt
tggaagggggcccagagcctgatcctgggggccccccgccatcagcatactgggaaggct
gtcatcttcacccagacgtccgggcaatggaggccgaaggctgaagtcgcagggacccag
attggctcctactttggggcctccctcctcgctgtggacgtggatagagatggcagctct
gaccttgtcctcatcggggctccccattactacaagccgagccaggggggccaggtgtct
gtgtgccccttcccccaggggagggctaagtggcagtgtgcggtcattctctgtggggag
cagggccacccctggggccgctttggggcagccctgacagtgctgggggatgtgaatggg
gacaagctgacagacgcggccattggagccccaggagaggaggagagccggggtgctgtc
tacctatttcatggaacctcaagaccgggcatcagtccctcccacagtcagaggatctca
gcctcccagctctcccccaggctccagtattttgggcagtcactgagtgggggtcaggac
cttaccctggatggactggtggaccttgctgtgggggcccagggacaggtgctgctgctc
aggaccagacctgtactcagggtgtggatgagtgtccgattcaaaccttcagagatagcc
aggtctctgtttgagtgtcggaaagagacctcctctgtcaacaccctgggtgatgccgat
gtctgccttcatattgatgaaagtcccaagaatcggctgggtaacctccaaagctctgtg
acctttgacctgaccctcgaccctggccgccagaatccccgtgccatctttgaggagaca
aagacctggaacctgactcgtgtccgagaccttgggctgcgacagcactgtgagactgtc
aagttgctgctcctggcctgtgtggaggacacagtgacccccatcaccttgcgtctcaac
ttctccctggtgggcaagcctatcccttcctttggaaacctccggcctatgttggctgtg
gatgctcagagatattacacagcctctctcccctttgagaagaattgtggaactgaccat
gtctgccaggatgaccttggcatctcctttggcttctcaggcttggagaccctgttggtg
gggagtaccctggagctgaatatgaaagtgatggtgtggaatgatggtgaggactcctat
ggaaccacagtcactctcttctacccgccagggctgtcttatcgacgcgtggcagagatc
aagaaccagctgcagccacactccccacgcctgacctgtgatggcgtcccagcccagggc
cagagcactcagagcacccgctgcagcatcaaccatctcatcctccaggagggtagccag
atcaccttcctggtcacctttgatgtctcccccaaggccgtgctgggagaccggctgctt
ctgacggctaacgtgagcagtgaaaataacactcccaggaccaacaagagcacctttcag
ctggagctcatggtgaaatatgccatctacaccgtaatcagcagccatgaacagtccacc
aagtacctcaacttctcagcctcagaccagaagaaaagcagccaggctcagcatagatac
cgggtgaacaacctgggacaaagggacctgccgatcagcatcatcttctctgtgcctgtg
gagctgaatggggtacctgtgtggacagacttagaggtcttccatccccagaacccctcc
attcagtgctcttcagagagaatagtacacacagagtctgacttcctaaagcacattcag
aagaattctctgctgaactgctccatcgctgactgtctgaggtaccagtgtgacttcccc
tcctttggcatccaggaggaactggacttcgtcctgaagggcaacctcagttttggttgg
gtcagccagacatcgcagaagaaggtattggtggtgagtgtggctgaaatcacattcaac
aggtccgtgtactcccagcttccaggacaggaggcattcttgagagctcagatagagacg
gtgctggagaaatatgaggtctacaaccccctccccattattgtgggaagctctgtggga
ggactgctgctgctggctctcatcacagccatcctatacaaggttggcttcttcaaacgt
cagtataaagaaatgatggcggaagcaagtggacagactgtcccagaagatgggacttca
ggccctcaagttgcccaataa

DBGET integrated database retrieval system