Ailuropoda melanoleuca (giant panda): 100475516 Help Entry 100475516         CDS       T01329                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04015   Rap1 signaling pathway aml04810   Regulation of actin cytoskeleton aml05014   Amyotrophic lateral sclerosis aml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100475516 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100475516 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100475516 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100475516 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100475516 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aml04812]     100475516 (PFN3)    04147 Exosome [BR:aml04147]     100475516 (PFN3) Membrane trafficking [BR:aml04131]  Others   Actin-binding proteins    Others     100475516 (PFN3) Cytoskeleton proteins [BR:aml04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100475516 (PFN3) Exosome [BR:aml04147]  Exosomal proteins   Proteins found in most exosomes    100475516 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100475516 NCBI-ProteinID:  XP_034512558 Ensembl:  ENSAMEG00000019587 UniProt:  G1MMQ7 LinkDB All DBs Position 3:83041217..83043825 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGYSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELIKGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggactggaaaggctatatcagtgcggtgctgcgagaccagcgcattgacgacgta gccatcgtgggctactcagacaatcgctgcgtgtgggcatcgcgcccaggaggccttctg gctgccatatcaccgcaagaggtgggtgtgctcacagggcctgatcggcgcaccttcctg caggccggcctgagcgtggcaggccgccgctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcacgcactaaggggctggatgggcgtgcggtctgcgtg ggccacaccccgcgcgtgctcctcgtgctcatgggccgacggggcgtgcacggcggcatc ctcaacaagacagtgcatgaactgatcaaggggctgcgcacacagggcacctag

DBGET integrated database retrieval system