Ailuropoda melanoleuca (giant panda): 100476676 Help Entry 100476676         CDS       T01329                                  Symbol RAB11B Name (RefSeq) ras-related protein Rab-11B   KO K07905   Ras-related protein Rab-11B Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04144   Endocytosis aml04152   AMPK signaling pathway aml04962   Vasopressin-regulated water reabsorption aml05164   Influenza A Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     100476676 (RAB11B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100476676 (RAB11B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100476676 (RAB11B)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100476676 (RAB11B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100476676 (RAB11B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100476676 (RAB11B)    04031 GTP-binding proteins [BR:aml04031]     100476676 (RAB11B) Membrane trafficking [BR:aml04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     100476676 (RAB11B) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100476676 (RAB11B)   Exosomal proteins of other body fluids (saliva and urine)    100476676 (RAB11B)   Exosomal proteins of colorectal cancer cells    100476676 (RAB11B) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     100476676 (RAB11B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_22 PduV-EutP AAA_16 ABC_tran FeoB_N TniB NTPase_1 Gtr1_RagA AAA_14 DUF3289 AAA_24 MCM AAA_5 AAA_29 AAA_7 Motif Other DBs NCBI-GeneID:  100476676 NCBI-ProteinID:  XP_034513561 Ensembl:  ENSAMEG00000004955 LinkDB All DBs Position 4 Genome browser AA seq 180 aa AA seqDB search MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTGGHRAWLGPW NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atggggacccgggacgacgagtacgactacctattcaaagtggtgctcattggggactcg ggcgtggggaagagcaacctgctatcacgcttcacccgcaacgagttcaacctggagagc aagagcaccatcggcgtggaatttgccacccgcagcatccaggtggacggcaagaccatc aaggcgcagatctgggacaccgccggccaggagcgctaccgtgccatcacctccgcgtac taccgcggcgcagtgggcgcgctgctcgtgtatgacatcgccaagcacctgacctacgag aacgtggagcgctggctgaaggagctgagggaccacgccgacagcaacatcgtcatcatg ctggtgggcaacaagagtgacctgcgccacctgcgggccgtgcccactgacgaggctcgt gcctttgcagaaaagaacaacttgtctttcattgagacctcagccttggattctaccaac gtcgaggaagctttcaagaacatcctcacaggtgggcacagggcctggctggggccatgg taa

DBGET integrated database retrieval system