Ailuropoda melanoleuca (giant panda): 100476723 Help Entry 100476723         CDS       T01329                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04014   Ras signaling pathway aml04015   Rap1 signaling pathway aml04022   cGMP-PKG signaling pathway aml04024   cAMP signaling pathway aml04062   Chemokine signaling pathway aml04071   Sphingolipid signaling pathway aml04072   Phospholipase D signaling pathway aml04081   Hormone signaling aml04144   Endocytosis aml04150   mTOR signaling pathway aml04270   Vascular smooth muscle contraction aml04310   Wnt signaling pathway aml04350   TGF-beta signaling pathway aml04360   Axon guidance aml04510   Focal adhesion aml04520   Adherens junction aml04530   Tight junction aml04611   Platelet activation aml04621   NOD-like receptor signaling pathway aml04625   C-type lectin receptor signaling pathway aml04660   T cell receptor signaling pathway aml04670   Leukocyte transendothelial migration aml04722   Neurotrophin signaling pathway aml04810   Regulation of actin cytoskeleton aml04921   Oxytocin signaling pathway aml04928   Parathyroid hormone synthesis, secretion and action aml04972   Pancreatic secretion aml05100   Bacterial invasion of epithelial cells aml05132   Salmonella infection aml05133   Pertussis aml05135   Yersinia infection aml05152   Tuberculosis aml05163   Human cytomegalovirus infection aml05200   Pathways in cancer aml05203   Viral carcinogenesis aml05205   Proteoglycans in cancer aml05206   MicroRNAs in cancer aml05210   Colorectal cancer aml05417   Lipid and atherosclerosis aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100476723 (RHOA)    04015 Rap1 signaling pathway     100476723 (RHOA)    04310 Wnt signaling pathway     100476723 (RHOA)    04350 TGF-beta signaling pathway     100476723 (RHOA)    04072 Phospholipase D signaling pathway     100476723 (RHOA)    04071 Sphingolipid signaling pathway     100476723 (RHOA)    04024 cAMP signaling pathway     100476723 (RHOA)    04022 cGMP-PKG signaling pathway     100476723 (RHOA)    04150 mTOR signaling pathway     100476723 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     100476723 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100476723 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100476723 (RHOA)    04660 T cell receptor signaling pathway     100476723 (RHOA)    04670 Leukocyte transendothelial migration     100476723 (RHOA)    04062 Chemokine signaling pathway     100476723 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     100476723 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     100476723 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     100476723 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100476723 (RHOA)   09158 Development and regeneration    04360 Axon guidance     100476723 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100476723 (RHOA)    05206 MicroRNAs in cancer     100476723 (RHOA)    05205 Proteoglycans in cancer     100476723 (RHOA)    05203 Viral carcinogenesis     100476723 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     100476723 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100476723 (RHOA)   09171 Infectious disease: bacterial    05135 Yersinia infection     100476723 (RHOA)    05133 Pertussis     100476723 (RHOA)    05152 Tuberculosis     100476723 (RHOA)    05100 Bacterial invasion of epithelial cells     100476723 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100476723 (RHOA)    05418 Fluid shear stress and atherosclerosis     100476723 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100476723 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100476723 (RHOA)    04031 GTP-binding proteins [BR:aml04031]     100476723 (RHOA) Membrane trafficking [BR:aml04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100476723 (RHOA) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100476723 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    100476723 (RHOA)   Exosomal proteins of colorectal cancer cells    100476723 (RHOA)   Exosomal proteins of bladder cancer cells    100476723 (RHOA) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100476723 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  100476723 NCBI-ProteinID:  XP_002920591 Ensembl:  ENSAMEG00000012584 UniProt:  D2HEV2 LinkDB All DBs Position 4:complement(17956801..18012840) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatgggaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc ccggaagtcaagcacttctgtcccaacgtacccatcatcctggttgggaacaagaaggac cttcggaatgatgagcacacacggcgggagctagccaagatgaagcaggagccagtgaaa ccggaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system