Ailuropoda melanoleuca (giant panda): 100478145 Help Entry 100478145         CDS       T01329                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04014   Ras signaling pathway aml04015   Rap1 signaling pathway aml04020   Calcium signaling pathway aml04151   PI3K-Akt signaling pathway aml04714   Thermogenesis aml04810   Regulation of actin cytoskeleton aml05200   Pathways in cancer aml05218   Melanoma aml05224   Breast cancer aml05226   Gastric cancer Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100478145 (FGF21)    04014 Ras signaling pathway     100478145 (FGF21)    04015 Rap1 signaling pathway     100478145 (FGF21)    04020 Calcium signaling pathway     100478145 (FGF21)    04151 PI3K-Akt signaling pathway     100478145 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100478145 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     100478145 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100478145 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     100478145 (FGF21)    05218 Melanoma     100478145 (FGF21)    05224 Breast cancer     100478145 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100478145 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100478145 (FGF21) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Growth factors (RTK binding)    100478145 (FGF21) Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Growth factors/receptors    100478145 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100478145 NCBI-ProteinID:  XP_034493835 Ensembl:  ENSAMEG00000014759 UniProt:  G1M873 LinkDB All DBs Position 12:complement(31147155..31149502) Genome browser AA seq 209 aa AA seqDB search MGWDEARSEQLGLWVPVLAVLLLEACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH LAIRADGTVVGAASRSPESLLELKALKPGVIQILGVKTSRFLCQGPDGTLYGSLRFDPVA CSFRELLLEDGYNIYHSETLGLPLRLPAHNSPYRDSAPRGPARFLPLPGLLPVPPDPPGI LGPEPPDVGSSDPLSMVGPSQGRSPSYAS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggctgggacgaggccaggtccgagcagctggggctgtgggtccctgtgctggctgtc cttttgctggaagcttgccaggcacaccctatccctgactccagccccctcctccaattc ggaggccaagttcgacagcggtacctctacacggacgatgcccaggagacagaggcccac ctagcgatcagggctgatggcacagtggtgggggctgccagccggagcccagaaagtctc ttggagctgaaagccctgaaaccgggggtcattcaaatcctgggagtgaaaacatctagg ttcctgtgccagggcccagatgggacactgtacggatcgctccgcttcgaccccgtagcc tgcagcttccgggaactgctcctggaggatgggtacaacatctaccactctgagaccctc ggcctcccacttcgcctgcccgcccacaactctccataccgggactcggcgccccggggg cctgcccgcttcctgcccctgccaggcctgcttccggtccccccggaccccccagggatc ctgggccccgagcctcccgacgtgggctcctcggaccccctgagcatggtggggccttca cagggccgaagtcccagctacgcttcctga

DBGET integrated database retrieval system