Ailuropoda melanoleuca (giant panda): 100478321 Help Entry 100478321         CDS       T01329                                  Name (RefSeq) interferon alpha-1/2   KO K05414   interferon alpha Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04151   PI3K-Akt signaling pathway aml04217   Necroptosis aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04622   RIG-I-like receptor signaling pathway aml04623   Cytosolic DNA-sensing pathway aml04630   JAK-STAT signaling pathway aml04650   Natural killer cell mediated cytotoxicity aml04936   Alcoholic liver disease aml05152   Tuberculosis aml05160   Hepatitis C aml05161   Hepatitis B aml05162   Measles aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05165   Human papillomavirus infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05168   Herpes simplex virus 1 infection aml05169   Epstein-Barr virus infection aml05170   Human immunodeficiency virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05320   Autoimmune thyroid disease aml05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100478321    04151 PI3K-Akt signaling pathway     100478321   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100478321  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100478321  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100478321    04621 NOD-like receptor signaling pathway     100478321    04622 RIG-I-like receptor signaling pathway     100478321    04623 Cytosolic DNA-sensing pathway     100478321    04650 Natural killer cell mediated cytotoxicity     100478321  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100478321   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100478321    05161 Hepatitis B     100478321    05160 Hepatitis C     100478321    05171 Coronavirus disease - COVID-19     100478321    05164 Influenza A     100478321    05162 Measles     100478321    05168 Herpes simplex virus 1 infection     100478321    05163 Human cytomegalovirus infection     100478321    05167 Kaposi sarcoma-associated herpesvirus infection     100478321    05169 Epstein-Barr virus infection     100478321    05165 Human papillomavirus infection     100478321   09171 Infectious disease: bacterial    05152 Tuberculosis     100478321   09163 Immune disease    05320 Autoimmune thyroid disease     100478321   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100478321   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100478321  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100478321 Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interferons    100478321 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100478321 NCBI-ProteinID:  XP_002918581 Ensembl:  ENSAMEG00000030690 UniProt:  D2H9P4 LinkDB All DBs Position 7:complement(13843336..13844145) Genome browser AA seq 187 aa AA seqDB search MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTHDFA FPKEVVDGKQLQKAQALSVVHVMDQKIFHVFCTEPSSAAWNRTLLEEFCSGLSEQLSVLE ACPMQAAGVGETPVRNVDSILRNYFQRISLYLQEKQYSPCAWETVRAEITSSLFSSAILQ EGLRRKK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc tctctgggatgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacatgactttgcc ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg catgtgatggaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg aacaggaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa gcctgtcccatgcaggcggcgggagtgggagagactcccgtcaggaatgtggactccatc ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcccttgt gcctgggagactgtcagagcagaaatcacgagctccttgttttcatcagcgatcttgcaa gaaggactaaggcgcaagaaatga

DBGET integrated database retrieval system