Ailuropoda melanoleuca (giant panda): 100478571 Help Entry 100478571         CDS       T01329                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04610   Complement and coagulation cascades aml04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100478571 (CD59)    04610 Complement and coagulation cascades     100478571 (CD59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100478571 (CD59)    04090 CD molecules [BR:aml04090]     100478571 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]     100478571 (CD59) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100478571 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    100478571 (CD59)   Exosomal proteins of colorectal cancer cells    100478571 (CD59) CD molecules [BR:aml04090]  Proteins   100478571 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:aml00537]  Antigens   100478571 (CD59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Abhydrolase_8 Motif Other DBs NCBI-GeneID:  100478571 NCBI-ProteinID:  XP_002917533 Ensembl:  ENSAMEG00000007332 UniProt:  G1LL89 LinkDB All DBs Position 16:complement(64214183..64234825) Genome browser AA seq 120 aa AA seqDB search MGSKGGSILLLLVLAVLCHSGGSLTCYTCVDNKACNKTTVCSVNFDTCLWVKAEPEVFQH QCWKFDDCNYNYISKTLGLRKLEYHCCQQDLCNRDAAASISGKTALLLVPLLAAVWTLCL NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgggaagcaaaggaggctccatcctgctcctgctcgtcttggctgtcctctgccattca ggtgggagcctgacctgctacacctgtgttgacaacaaagcctgcaataagaccaccgtg tgctcggttaattttgatacatgtctttgggtcaaagctgagccagaagtttttcaacac cagtgttggaagtttgatgattgcaattacaactacatttcaaaaaccctcgggctgagg aagctggagtaccactgctgtcaacaggacctgtgtaacagggacgcggccgcgagcatc tccgggaagacggctctcctgctggtccctttgctggcggcagtctggaccctttgtctc tga

DBGET integrated database retrieval system