Ailuropoda melanoleuca (giant panda): 100479771 Help Entry 100479771         CDS       T01329                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04613   Neutrophil extracellular trap formation aml05034   Alcoholism aml05203   Viral carcinogenesis aml05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100479771  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100479771   09163 Immune disease    05322 Systemic lupus erythematosus     100479771   09165 Substance dependence    05034 Alcoholism     100479771  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100479771 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100479771 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  100479771 NCBI-ProteinID:  XP_034516024 LinkDB All DBs Position 5:2249498..2249883 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc tttgggggctaa

DBGET integrated database retrieval system