Ailuropoda melanoleuca (giant panda): 100480073 Help Entry 100480073         CDS       T01329                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04137   Mitophagy - animal aml04140   Autophagy - animal aml04144   Endocytosis aml04145   Phagosome aml04148   Efferocytosis aml05132   Salmonella infection aml05146   Amoebiasis aml05152   Tuberculosis Brite KEGG Orthology (KO) [BR:aml00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100480073 (RAB7A)    04145 Phagosome     100480073 (RAB7A)    04140 Autophagy - animal     100480073 (RAB7A)    04137 Mitophagy - animal     100480073 (RAB7A)    04148 Efferocytosis     100480073 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100480073 (RAB7A)    05152 Tuberculosis     100480073 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100480073 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100480073 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100480073 (RAB7A)    04031 GTP-binding proteins [BR:aml04031]     100480073 (RAB7A) Membrane trafficking [BR:aml04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     100480073 (RAB7A) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100480073 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    100480073 (RAB7A)   Exosomal proteins of colorectal cancer cells    100480073 (RAB7A)   Exosomal proteins of bladder cancer cells    100480073 (RAB7A) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     100480073 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  100480073 NCBI-ProteinID:  XP_002917684 Ensembl:  ENSAMEG00000015249 UniProt:  G1M9R1 LinkDB All DBs Position 4:complement(55226586..55294661) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagtcacaatgcag atctgggacacggcaggccaggagcggttccagtccctcggcgtggccttctacagaggc gcagactgctgcgttctggtctttgacgttactgcccccaacacgttcaaaacccttgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttc gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacaattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacaatgaattccccgaacccatcaaactggacaagaacgaccgggccaaggcc tcggcggaaagctgcagttgctga

DBGET integrated database retrieval system