Ailuropoda melanoleuca (giant panda): 100480862 Help Entry 100480862         CDS       T01329                                  Symbol IL2 Name (RefSeq) interleukin-2 precursor   KO K05429   interleukin 2 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04151   PI3K-Akt signaling pathway aml04625   C-type lectin receptor signaling pathway aml04630   JAK-STAT signaling pathway aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04672   Intestinal immune network for IgA production aml04940   Type I diabetes mellitus aml05135   Yersinia infection aml05142   Chagas disease aml05162   Measles aml05166   Human T-cell leukemia virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05320   Autoimmune thyroid disease aml05321   Inflammatory bowel disease aml05330   Allograft rejection aml05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100480862 (IL2)    04151 PI3K-Akt signaling pathway     100480862 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100480862 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     100480862 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100480862 (IL2)    04660 T cell receptor signaling pathway     100480862 (IL2)    04658 Th1 and Th2 cell differentiation     100480862 (IL2)    04659 Th17 cell differentiation     100480862 (IL2)    04672 Intestinal immune network for IgA production     100480862 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100480862 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100480862 (IL2)    05171 Coronavirus disease - COVID-19     100480862 (IL2)    05162 Measles     100480862 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     100480862 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     100480862 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     100480862 (IL2)    05321 Inflammatory bowel disease     100480862 (IL2)    05330 Allograft rejection     100480862 (IL2)    05332 Graft-versus-host disease     100480862 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100480862 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100480862 (IL2)    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100480862 (IL2) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interleukins    100480862 (IL2) Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Cytokines    100480862 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Portal_T4 Motif Other DBs NCBI-GeneID:  100480862 NCBI-ProteinID:  NP_001291800 Ensembl:  ENSAMEG00000005901 UniProt:  Q5PXD0 H2DL90 LinkDB All DBs Position 5:128915791..128919970 Genome browser AA seq 155 aa AA seqDB search MYKMQLLYCIALTLVLVANSAPTPSSPTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM LTFKFYMPKKATELKHLQCLAEELKLLEEVLYLDQSKNLHLTDIKELMSNINVTLLKLKG SEASFKCEYDDETVTITEFLNKWITFCQSIFSTLT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaatgcaactcttgtattgcatcgcactgactcttgtactcgtcgcaaacagt gcacctactccttcaagccctacgaaggaaacacagcaacagctggagcaattgctgctg gatttacggttgctcttgaatggagttaataattatgagaaccccaaactctccaggatg ctcacgtttaaattctacatgcccaagaaggccacagaattgaaacatcttcaatgtcta gcagaagaactcaaacttctggaggaagtgctatatttagatcaaagcaaaaaccttcac ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga tcagaagcaagtttcaaatgtgaatatgatgacgagacagtaaccatcacagaatttctg aacaaatggattactttttgtcaaagcatcttctcaacactgacttaa

DBGET integrated database retrieval system