Ailuropoda melanoleuca (giant panda): 100480874 Help Entry 100480874         CDS       T01329                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01523   Antifolate resistance aml04010   MAPK signaling pathway aml04060   Cytokine-cytokine receptor interaction aml04064   NF-kappa B signaling pathway aml04217   Necroptosis aml04380   Osteoclast differentiation aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04623   Cytosolic DNA-sensing pathway aml04625   C-type lectin receptor signaling pathway aml04640   Hematopoietic cell lineage aml04657   IL-17 signaling pathway aml04659   Th17 cell differentiation aml04668   TNF signaling pathway aml04750   Inflammatory mediator regulation of TRP channels aml04932   Non-alcoholic fatty liver disease aml04933   AGE-RAGE signaling pathway in diabetic complications aml04936   Alcoholic liver disease aml04940   Type I diabetes mellitus aml05010   Alzheimer disease aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05132   Salmonella infection aml05133   Pertussis aml05134   Legionellosis aml05135   Yersinia infection aml05140   Leishmaniasis aml05142   Chagas disease aml05143   African trypanosomiasis aml05144   Malaria aml05146   Amoebiasis aml05152   Tuberculosis aml05162   Measles aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05168   Herpes simplex virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05321   Inflammatory bowel disease aml05323   Rheumatoid arthritis aml05332   Graft-versus-host disease aml05417   Lipid and atherosclerosis aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100480874 (IL1B)    04064 NF-kappa B signaling pathway     100480874 (IL1B)    04668 TNF signaling pathway     100480874 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100480874 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100480874 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100480874 (IL1B)    04620 Toll-like receptor signaling pathway     100480874 (IL1B)    04621 NOD-like receptor signaling pathway     100480874 (IL1B)    04623 Cytosolic DNA-sensing pathway     100480874 (IL1B)    04625 C-type lectin receptor signaling pathway     100480874 (IL1B)    04659 Th17 cell differentiation     100480874 (IL1B)    04657 IL-17 signaling pathway     100480874 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100480874 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     100480874 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100480874 (IL1B)    05164 Influenza A     100480874 (IL1B)    05162 Measles     100480874 (IL1B)    05168 Herpes simplex virus 1 infection     100480874 (IL1B)    05163 Human cytomegalovirus infection     100480874 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     100480874 (IL1B)    05135 Yersinia infection     100480874 (IL1B)    05133 Pertussis     100480874 (IL1B)    05134 Legionellosis     100480874 (IL1B)    05152 Tuberculosis     100480874 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100480874 (IL1B)    05144 Malaria     100480874 (IL1B)    05140 Leishmaniasis     100480874 (IL1B)    05142 Chagas disease     100480874 (IL1B)    05143 African trypanosomiasis     100480874 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     100480874 (IL1B)    05321 Inflammatory bowel disease     100480874 (IL1B)    05332 Graft-versus-host disease     100480874 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100480874 (IL1B)    05020 Prion disease     100480874 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     100480874 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100480874 (IL1B)    05418 Fluid shear stress and atherosclerosis     100480874 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100480874 (IL1B)    04936 Alcoholic liver disease     100480874 (IL1B)    04932 Non-alcoholic fatty liver disease     100480874 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     100480874 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100480874 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100480874 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100480874 (IL1B) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interleukins    100480874 (IL1B) Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Cytokines    100480874 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  100480874 NCBI-ProteinID:  XP_002926376 Ensembl:  ENSAMEG00000010733 UniProt:  G1LW44 LinkDB All DBs Position 4:107484750..107491532 Genome browser AA seq 269 aa AA seqDB search MARVPEPTSEMSYYCSDSENDLSFEADGPSKMKCCFQDLNSSFLEDEGIQLHISHQLQNK SLRHFVSVVVALEKLKKISLPSSQLFQDDDLKNVFSCIFEEEPIICEAYDDDALVCDAPL QSLDCKFWDVNQKSLVLYNSYELRALHLNGSSVNQQAVFRMSFVQGDESSNKIPVALCIK EKNLYLSCVMKDGKPTLQLEMLDPRVYPKKKMEKRFVFNKTQIKKRLEFESAQFPNWYIS TSQAEEMPVFLGNTKGGQDITDFTMELTS NT seq 810 nt NT seq  +upstreamnt  +downstreamnt atggcaagagtacctgaacccaccagtgaaatgtcttactactgcagtgacagtgagaat gacctatcctttgaggctgatggccccagcaagatgaagtgctgcttccaagacctgaat agcagctttctggaagatgagggcatccagctgcacatttcccaccagctccagaacaag agtctgaggcatttcgtgtcagtcgttgtggctttggagaagctgaagaagatctcttta cccagctcacagctcttccaggatgatgacctgaagaatgtcttttcctgcatctttgaa gaagaacccatcatctgtgaagcgtatgatgatgatgcccttgtgtgtgatgcacccctg caatcgctggactgcaagttctgggacgtgaaccaaaaatccctggtgctgtataactcg tatgagttgcgggctctccacctcaatgggagtagtgtgaaccaacaagcggtgttccgc atgagctttgtgcaaggggatgaaagtagtaacaagatacctgtggccttgtgcatcaag gaaaagaatctgtacctgtcctgtgtgatgaaagacgggaagcccaccctgcagctggag atgttagaccccagagtttacccaaagaagaagatggaaaagcgatttgtcttcaacaag acacaaatcaagaagaggttggaatttgagtctgcccagttccccaactggtacatcagc acctctcaagcagaagaaatgcctgtcttcctgggaaataccaaaggtggtcaggatata actgacttcaccatggaactcacttcctag

DBGET integrated database retrieval system