Ailuropoda melanoleuca (giant panda): 100481122 Help Entry 100481122         CDS       T01329                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04060   Cytokine-cytokine receptor interaction aml04217   Necroptosis aml04218   Cellular senescence aml04380   Osteoclast differentiation aml04640   Hematopoietic cell lineage aml04932   Non-alcoholic fatty liver disease aml04933   AGE-RAGE signaling pathway in diabetic complications aml04940   Type I diabetes mellitus aml05010   Alzheimer disease aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05133   Pertussis aml05140   Leishmaniasis aml05152   Tuberculosis aml05162   Measles aml05164   Influenza A aml05321   Inflammatory bowel disease aml05323   Rheumatoid arthritis aml05332   Graft-versus-host disease aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100481122 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100481122 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100481122 (IL1A)    04218 Cellular senescence     100481122 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100481122 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     100481122 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100481122 (IL1A)    05162 Measles     100481122 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     100481122 (IL1A)    05152 Tuberculosis     100481122 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100481122 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     100481122 (IL1A)    05321 Inflammatory bowel disease     100481122 (IL1A)    05332 Graft-versus-host disease     100481122 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     100481122 (IL1A)    05020 Prion disease     100481122 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     100481122 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100481122 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100481122 (IL1A)    04932 Non-alcoholic fatty liver disease     100481122 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     100481122 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100481122 (IL1A) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interleukins    100481122 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  100481122 NCBI-ProteinID:  XP_011232040 Ensembl:  ENSAMEG00000010754 UniProt:  G1LW58 LinkDB All DBs Position 4:107531391..107541041 Genome browser AA seq 265 aa AA seqDB search MAKVPDLFEDLKNCCSENEEYSSEIDHLSLNQKSFYDVSYDPLHEDCMSLSTSETSKTSQ LTFKENVVVVATNGKILKKRRLSLNQFITDDDLEAITNDAEEEIMKPRSAAYNFSGNEKY NYMRIIKSQFILNDNLNQSIIQQPGGNYLMAAALQNLDDAAKFDMGAYTSEDSKLPVTLR ISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGTKNYFTSVAQPKLFIAT QEQKLVHMARGQPSITDFQILETQP NT seq 798 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttcctgacctttttgaagacctgaagaactgttgcagtgaaaatgaagaa tacagttctgaaattgaccatctttctctgaatcagaaatctttctatgatgtgagctat gacccacttcatgaggactgcatgtctctgagtacctctgaaacctcaaagacatctcag cttactttcaaggagaatgtggtggtggtggcaaccaatgggaagattctaaagaagaga cggttgagtttaaatcaattcatcacagatgatgacctggaagccattaccaatgatgca gaagaagaaatcatgaagcccagatcagcagcatacaacttcagcggtaatgaaaaatac aactatatgaggatcatcaaatcccaattcatccttaatgacaacctcaatcaaagtata attcaacaaccagggggaaattacctcatggctgctgcattacagaatctggatgatgca gcgaaatttgacatgggagcttatacatcagaagattcgaaacttcctgtgactctaaga atctcaaaaactcgactgtttgtgagtgcccaaaatgaagatgaacctgtattgctaaag gagatgcctgagacacccaaaaccatcagagatgagaccaaccttcttttcttctgggaa cgtcatggcactaagaactacttcacatcagtggcccagccaaagttgttcattgccaca caggaacaaaaactggtacacatggcaagagggcaaccctctatcactgactttcagata ctggaaacccagccttga

DBGET integrated database retrieval system