Ailuropoda melanoleuca (giant panda): 100481281 Help Entry 100481281         CDS       T01329                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04014   Ras signaling pathway aml04137   Mitophagy - animal aml04144   Endocytosis aml04145   Phagosome aml04148   Efferocytosis aml04962   Vasopressin-regulated water reabsorption aml05014   Amyotrophic lateral sclerosis aml05022   Pathways of neurodegeneration - multiple diseases aml05132   Salmonella infection aml05146   Amoebiasis aml05152   Tuberculosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100481281 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100481281 (RAB5A)    04145 Phagosome     100481281 (RAB5A)    04137 Mitophagy - animal     100481281 (RAB5A)    04148 Efferocytosis     100481281 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100481281 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100481281 (RAB5A)    05152 Tuberculosis     100481281 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100481281 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100481281 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     100481281 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     100481281 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100481281 (RAB5A)    04031 GTP-binding proteins [BR:aml04031]     100481281 (RAB5A) Membrane trafficking [BR:aml04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100481281 (RAB5A)  Endosome - Lysosome transport     100481281 (RAB5A) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100481281 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    100481281 (RAB5A)   Exosomal proteins of colorectal cancer cells    100481281 (RAB5A)   Exosomal proteins of bladder cancer cells    100481281 (RAB5A) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100481281 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  100481281 NCBI-ProteinID:  XP_002927485 Ensembl:  ENSAMEG00000000954 UniProt:  D2HXC6 LinkDB All DBs Position 6:21754675..21782916 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggcccaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccaatttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system