Ailuropoda melanoleuca (giant panda): 100481406 Help Entry 100481406         CDS       T01329                                  Symbol BMP6 Name (RefSeq) bone morphogenetic protein 6   KO K16620   bone morphogenetic protein 6 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04350   TGF-beta signaling pathway aml04390   Hippo signaling pathway aml04913   Ovarian steroidogenesis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     100481406 (BMP6)    04390 Hippo signaling pathway     100481406 (BMP6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100481406 (BMP6)  09150 Organismal Systems   09152 Endocrine system    04913 Ovarian steroidogenesis     100481406 (BMP6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100481406 (BMP6) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Transforming growth factors (RSTK binding)    100481406 (BMP6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TGF_beta Motif Other DBs NCBI-GeneID:  100481406 NCBI-ProteinID:  XP_034516239 LinkDB All DBs Position 5:complement(18374305..18376347) Genome browser AA seq 99 aa AA seqDB search MLTTCGALLLSPKDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVP KPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgctgaccacatgtggcgcccttttgctttcacctaaggactggatcatcgcacccaag ggctacgccgccaactactgtgatggagagtgctccttcccactcaacgcgcacatgaac gcgaccaaccacgcgatcgtgcagacgctggttcaccttatgaatcccgagtacgtcccc aaaccatgctgcgcgccaaccaaactaaacgccatctcagttctttactttgatgacaac tccaatgtcatcttgaaaaaatacaggaatatggttgtcagggcttgtggatgccactaa

DBGET integrated database retrieval system