Ailuropoda melanoleuca (giant panda): 100483432 Help Entry 100483432         CDS       T01329                                  Symbol INS Name (RefSeq) insulin isoform X2   KO K04526   insulin Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04010   MAPK signaling pathway aml04014   Ras signaling pathway aml04015   Rap1 signaling pathway aml04022   cGMP-PKG signaling pathway aml04066   HIF-1 signaling pathway aml04068   FoxO signaling pathway aml04072   Phospholipase D signaling pathway aml04081   Hormone signaling aml04114   Oocyte meiosis aml04140   Autophagy - animal aml04150   mTOR signaling pathway aml04151   PI3K-Akt signaling pathway aml04152   AMPK signaling pathway aml04211   Longevity regulating pathway aml04213   Longevity regulating pathway - multiple species aml04810   Regulation of actin cytoskeleton aml04910   Insulin signaling pathway aml04911   Insulin secretion aml04913   Ovarian steroidogenesis aml04914   Progesterone-mediated oocyte maturation aml04917   Prolactin signaling pathway aml04923   Regulation of lipolysis in adipocytes aml04930   Type II diabetes mellitus aml04931   Insulin resistance aml04932   Non-alcoholic fatty liver disease aml04940   Type I diabetes mellitus aml04950   Maturity onset diabetes of the young aml04960   Aldosterone-regulated sodium reabsorption aml05010   Alzheimer disease aml05215   Prostate cancer aml05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100483432 (INS)    04015 Rap1 signaling pathway     100483432 (INS)    04066 HIF-1 signaling pathway     100483432 (INS)    04068 FoxO signaling pathway     100483432 (INS)    04072 Phospholipase D signaling pathway     100483432 (INS)    04022 cGMP-PKG signaling pathway     100483432 (INS)    04151 PI3K-Akt signaling pathway     100483432 (INS)    04152 AMPK signaling pathway     100483432 (INS)    04150 mTOR signaling pathway     100483432 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     100483432 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100483432 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     100483432 (INS)    04923 Regulation of lipolysis in adipocytes     100483432 (INS)    04913 Ovarian steroidogenesis     100483432 (INS)    04917 Prolactin signaling pathway     100483432 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100483432 (INS)   09149 Aging    04211 Longevity regulating pathway     100483432 (INS)    04213 Longevity regulating pathway - multiple species     100483432 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     100483432 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100483432 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     100483432 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100483432 (INS)    04940 Type I diabetes mellitus     100483432 (INS)    04950 Maturity onset diabetes of the young     100483432 (INS)    04932 Non-alcoholic fatty liver disease     100483432 (INS)    04931 Insulin resistance     100483432 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100483432 (INS) Cytokines and neuropeptides [BR:aml04052]  Neuropeptides   Unclassified    100483432 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  100483432 NCBI-ProteinID:  XP_002920166 Ensembl:  ENSAMEG00000026511 LinkDB All DBs Position 16:89612238..89613320 Genome browser AA seq 147 aa AA seqDB search MGQAVGLGAIKPGGPRSPQPPGTSCTLTRTASRSPSPAMALWTRLLPLLALLAVWAPVPA RTFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEDLPAGDAELDRVPGADPQPRALA GALQRRGIVEQCCTSICSLYQLENYCN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgggccaggcagtggggttgggagctataaagccaggagggccccgcagccctcagccc cctgggaccagctgcaccctgacacggacggctagcaggtccccgtcccccgccatggcc ctctggacgcgcctcctgcccctgctggctttgctggccgtctgggcgcctgtccctgcc agaaccttcgtgaaccagcacctgtgcggctcccacctggtggaggcgctctacctggtg tgcggggagcgtggctttttctacacgcccaaggcccgccgggaggtggaggacctgccg gcaggggacgcagagctggacagggtgcctggcgcagacccacagccccgggccctggcg ggggcgctgcaaagacggggcatcgtggagcagtgctgcaccagcatctgctcactctac cagctggagaattactgcaactag

DBGET integrated database retrieval system