Ailuropoda melanoleuca (giant panda): 100483834 Help Entry 100483834         CDS       T01329                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01522   Endocrine resistance aml04010   MAPK signaling pathway aml04012   ErbB signaling pathway aml04024   cAMP signaling pathway aml04137   Mitophagy - animal aml04210   Apoptosis aml04310   Wnt signaling pathway aml04380   Osteoclast differentiation aml04510   Focal adhesion aml04530   Tight junction aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04625   C-type lectin receptor signaling pathway aml04657   IL-17 signaling pathway aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04662   B cell receptor signaling pathway aml04668   TNF signaling pathway aml04722   Neurotrophin signaling pathway aml04912   GnRH signaling pathway aml04915   Estrogen signaling pathway aml04921   Oxytocin signaling pathway aml04926   Relaxin signaling pathway aml04932   Non-alcoholic fatty liver disease aml04933   AGE-RAGE signaling pathway in diabetic complications aml05030   Cocaine addiction aml05031   Amphetamine addiction aml05132   Salmonella infection aml05133   Pertussis aml05135   Yersinia infection aml05140   Leishmaniasis aml05142   Chagas disease aml05161   Hepatitis B aml05162   Measles aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05169   Epstein-Barr virus infection aml05170   Human immunodeficiency virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05203   Viral carcinogenesis aml05207   Chemical carcinogenesis - receptor activation aml05208   Chemical carcinogenesis - reactive oxygen species aml05210   Colorectal cancer aml05211   Renal cell carcinoma aml05224   Breast cancer aml05231   Choline metabolism in cancer aml05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aml05321   Inflammatory bowel disease aml05323   Rheumatoid arthritis aml05417   Lipid and atherosclerosis aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100483834 (JUN)    04012 ErbB signaling pathway     100483834 (JUN)    04310 Wnt signaling pathway     100483834 (JUN)    04668 TNF signaling pathway     100483834 (JUN)    04024 cAMP signaling pathway     100483834 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100483834 (JUN)   09143 Cell growth and death    04210 Apoptosis     100483834 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100483834 (JUN)    04530 Tight junction     100483834 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100483834 (JUN)    04621 NOD-like receptor signaling pathway     100483834 (JUN)    04625 C-type lectin receptor signaling pathway     100483834 (JUN)    04660 T cell receptor signaling pathway     100483834 (JUN)    04658 Th1 and Th2 cell differentiation     100483834 (JUN)    04659 Th17 cell differentiation     100483834 (JUN)    04657 IL-17 signaling pathway     100483834 (JUN)    04662 B cell receptor signaling pathway     100483834 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     100483834 (JUN)    04915 Estrogen signaling pathway     100483834 (JUN)    04921 Oxytocin signaling pathway     100483834 (JUN)    04926 Relaxin signaling pathway     100483834 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     100483834 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     100483834 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100483834 (JUN)    05207 Chemical carcinogenesis - receptor activation     100483834 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     100483834 (JUN)    05203 Viral carcinogenesis     100483834 (JUN)    05231 Choline metabolism in cancer     100483834 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100483834 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     100483834 (JUN)    05211 Renal cell carcinoma     100483834 (JUN)    05224 Breast cancer     100483834 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100483834 (JUN)    05170 Human immunodeficiency virus 1 infection     100483834 (JUN)    05161 Hepatitis B     100483834 (JUN)    05171 Coronavirus disease - COVID-19     100483834 (JUN)    05162 Measles     100483834 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     100483834 (JUN)    05169 Epstein-Barr virus infection     100483834 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     100483834 (JUN)    05135 Yersinia infection     100483834 (JUN)    05133 Pertussis     100483834 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100483834 (JUN)    05142 Chagas disease     100483834 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     100483834 (JUN)    05321 Inflammatory bowel disease     100483834 (JUN)   09165 Substance dependence    05030 Cocaine addiction     100483834 (JUN)    05031 Amphetamine addiction     100483834 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100483834 (JUN)    05418 Fluid shear stress and atherosclerosis     100483834 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100483834 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     100483834 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100483834 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:aml03000]     100483834 (JUN) Transcription factors [BR:aml03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     100483834 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  100483834 NCBI-ProteinID:  XP_019653006 LinkDB All DBs Position 2:complement(33033343..33035137) Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggatctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccactacgccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggcggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg cagcacccgcggcttcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgcctcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcagagagg aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc gccaggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system