Ailuropoda melanoleuca (giant panda): 100483836 Help Entry 100483836         CDS       T01329                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04022   cGMP-PKG signaling pathway aml04081   Hormone signaling aml04270   Vascular smooth muscle contraction aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     100483836 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     100483836 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     100483836 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100483836 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100483836 (NPPC) Cytokines and neuropeptides [BR:aml04052]  Neuropeptides   Unclassified    100483836 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  100483836 NCBI-ProteinID:  XP_011221659 LinkDB All DBs Position 2:complement(191655324..191660073) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRASWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctgcggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccgggggaggagctg gccgagccccaggctgcgggcggcggtcagaaaaagggcgacaaaactcccgggggcggc ggcgccaacctcaagggtgaccggtcgcgactgctccgcgacctgcgcgtggacaccaag tctcgggcctcgtgggcccgccttctgcatgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system