Ailuropoda melanoleuca (giant panda): 105236726 Help Entry 105236726         CDS       T01329                                  Name (RefSeq) metallothionein-2E-like   KO K14739   metallothionein 1/2 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04978   Mineral absorption Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105236726  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aml03019]     105236726    03029 Mitochondrial biogenesis [BR:aml03029]     105236726 Messenger RNA biogenesis [BR:aml03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105236726 Mitochondrial biogenesis [BR:aml03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105236726 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105236726 NCBI-ProteinID:  XP_011220629 Ensembl:  ENSAMEG00000030480 LinkDB All DBs Position 3:complement(50774914..50775141) Genome browser AA seq 75 aa AA seqDB search MDPNCSCSTRSSCTCSVSCRYKECTCTLCRKGCCSYCPIGHAKCAQGCICKEALDTCSCY ASCGGEPVPDVNIST NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcgtgctccaccaggagctcctgtacctgctctgtctcctgcaga tataaagagtgcacatgcaccttgtgcaggaagggctgctgctcctactgccccattggt catgccaagtgtgcccagggctgcatctgcaaggaggcattggacacatgcagctgctat gcctcatgtggaggagagcctgttccagatgtaaatatatcaacataa

DBGET integrated database retrieval system