Ailuropoda melanoleuca (giant panda): 105240041 Help Entry 105240041         CDS       T01329                                  Name (RefSeq) tubulin beta chain   KO K07375   tubulin beta Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04145   Phagosome aml04517   IgSF CAM signaling aml04540   Gap junction aml04814   Motor proteins aml05010   Alzheimer disease aml05012   Parkinson disease aml05014   Amyotrophic lateral sclerosis aml05016   Huntington disease aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105240041  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105240041   09144 Cellular community - eukaryotes    04540 Gap junction     105240041   09142 Cell motility    04814 Motor proteins     105240041  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105240041   09164 Neurodegenerative disease    05010 Alzheimer disease     105240041    05012 Parkinson disease     105240041    05014 Amyotrophic lateral sclerosis     105240041    05016 Huntington disease     105240041    05020 Prion disease     105240041    05022 Pathways of neurodegeneration - multiple diseases     105240041  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     105240041   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aml04812]     105240041    04147 Exosome [BR:aml04147]     105240041 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      105240041 Cytoskeleton proteins [BR:aml04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     105240041 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105240041   Exosomal proteins of colorectal cancer cells    105240041   Exosomal proteins of bladder cancer cells    105240041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tubulin Tubulin_3 Tubulin_2 Motif Other DBs NCBI-GeneID:  105240041 NCBI-ProteinID:  XP_034509179 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQG FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQL VENTDETYSIDNEALYDICFRTLKLTTPTYG NT seq 454 nt NT seq  +upstreamnt  +downstreamnt atggactccgtcaggtctgggccatttggccagatcttcaggccagacaacttcgtgttc ggccagagtggtgcaggaaacaactgggcaaagggccactacactgagggagccgaactg gtggactcagtcctggacgtggtgaggaaggagtcagaaagctgtgactgtctgcagggc ttccagctgacccactcgctggggggcggcacggggtccggcatgggcaccctgctcatc agcaagatccgggaggagtacccagaccgcatcatgaacaccttcagcgtcatgccctcg cccaaggtgtccgacacggtggtcgagccctacaacgccaccctgtccgtgcaccagctg gtggagaacacagacgaaacctattccatcgacaacgaagccctgtacgacatctgcttc cgcaccctgaaactgaccacgcccacgtacggag

DBGET integrated database retrieval system