Ailuropoda melanoleuca (giant panda): 109490262 Help Entry 109490262         CDS       T01329                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04015   Rap1 signaling pathway aml04810   Regulation of actin cytoskeleton aml05014   Amyotrophic lateral sclerosis aml05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109490262 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109490262 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109490262 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109490262 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     109490262 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aml04812]     109490262 (PFN2)    04147 Exosome [BR:aml04147]     109490262 (PFN2) Membrane trafficking [BR:aml04131]  Others   Actin-binding proteins    Others     109490262 (PFN2) Cytoskeleton proteins [BR:aml04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109490262 (PFN2) Exosome [BR:aml04147]  Exosomal proteins   Proteins found in most exosomes    109490262 (PFN2) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  109490262 NCBI-ProteinID:  XP_034517726 LinkDB All DBs Position 6:386174..409697 Genome browser AA seq 141 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFHSITPIEIDMIVGKDHREGF FTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGV HGGTLNKKAYELALYLRRSDV NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggcaggctggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgtgacgccaagtacgtctgggcagcgacggccgggggcatcttt cacagcattacgcctatagaaatagatatgattgtaggaaaagaccaccgggaaggtttc tttaccaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatac gtcgatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatac aacgttgctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtc cacggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgat gtgtaa

DBGET integrated database retrieval system