Ailuropoda melanoleuca (giant panda): 109490451 Help Entry 109490451         CDS       T01329                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04621   NOD-like receptor signaling pathway aml05012   Parkinson disease aml05132   Salmonella infection aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109490451  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109490451   09164 Neurodegenerative disease    05012 Parkinson disease     109490451   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109490451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aml03110]     109490451 Chaperones and folding catalysts [BR:aml03110]  Protein folding catalysts   Protein disulfide isomerase    109490451 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 Redoxin Thioredoxin_9 AhpC-TSA Glutaredoxin Motif Other DBs NCBI-GeneID:  109490451 NCBI-ProteinID:  XP_019660792 Ensembl:  ENSAMEG00000018017 LinkDB All DBs Position X:complement(109549311..109550785) Genome browser AA seq 93 aa AA seqDB search MVKQIKSKYAFQEALNSAGDKPVVVDFSATWCGPCKMTKPFFHSLSQKYSNDVTSECEVK CTPSFQFFKKGQKMGEFSGTNKGKLEATINELT NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagataaagagcaagtatgcttttcaggaagccttgaacagtgcaggagat aaaccagttgtagttgacttctcagccacatggtgtgggccttgcaaaatgaccaagcct ttctttcattccctctctcagaagtattccaacgatgtcacttcagaatgtgaagtcaaa tgcaccccatccttccagttttttaaaaagggacaaaagatgggtgaattttctggaact aataaggggaaacttgaagctaccattaatgaattaacctaa

DBGET integrated database retrieval system