Ailuropoda melanoleuca (giant panda): 117799396 Help Entry 117799396         CDS       T01329                                  Name (RefSeq) cofilin-1   KO K05765   cofilin Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04360   Axon guidance aml04666   Fc gamma R-mediated phagocytosis aml04810   Regulation of actin cytoskeleton aml05133   Pertussis aml05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:aml00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     117799396  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     117799396   09158 Development and regeneration    04360 Axon guidance     117799396  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     117799396   09171 Infectious disease: bacterial    05133 Pertussis     117799396  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aml04131]     117799396   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aml04812]     117799396    04147 Exosome [BR:aml04147]     117799396 Membrane trafficking [BR:aml04131]  Others   Actin-binding proteins    Others     117799396 Cytoskeleton proteins [BR:aml04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      117799396 Exosome [BR:aml04147]  Exosomal proteins   Proteins found in most exosomes    117799396 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  117799396 NCBI-ProteinID:  XP_034507763 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctccggtgtggctgtctctgatggtgtcatcaaggtgttcaacgacatgaaggtg cgtaagtcttcaacgccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggcgatgtg ggccagactgtcgacgacccctacgccacctttgtcaagatgctgccagataaggactgc cgctatgccctctatgatgcaacctatgagaccaaggagagcaagaaggaggatctggtg tttatcttctgggcccccgagtctgcgccccttaagagcaaaatgatttatgccagctcc aaggacgccatcaagaagaagctgacagggatcaagcatgaattgcaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagtgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system