KEGG   Ailuropoda melanoleuca (giant panda): 117799706
Entry
117799706         CDS       T01329                                 
Name
(RefSeq) calmodulin-alpha-like
  KO
K02183  calmodulin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04371  Apelin signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04728  Dopaminergic synapse
aml04740  Olfactory transduction
aml04744  Phototransduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml04925  Aldosterone synthesis and secretion
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05133  Pertussis
aml05152  Tuberculosis
aml05163  Human cytomegalovirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05214  Glioma
aml05417  Lipid and atherosclerosis
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    117799706
   04015 Rap1 signaling pathway
    117799706
   04371 Apelin signaling pathway
    117799706
   04020 Calcium signaling pathway
    117799706
   04070 Phosphatidylinositol signaling system
    117799706
   04024 cAMP signaling pathway
    117799706
   04022 cGMP-PKG signaling pathway
    117799706
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    117799706
   04218 Cellular senescence
    117799706
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    117799706
  09152 Endocrine system
   04910 Insulin signaling pathway
    117799706
   04922 Glucagon signaling pathway
    117799706
   04912 GnRH signaling pathway
    117799706
   04915 Estrogen signaling pathway
    117799706
   04921 Oxytocin signaling pathway
    117799706
   04916 Melanogenesis
    117799706
   04924 Renin secretion
    117799706
   04925 Aldosterone synthesis and secretion
    117799706
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    117799706
   04270 Vascular smooth muscle contraction
    117799706
  09154 Digestive system
   04970 Salivary secretion
    117799706
   04971 Gastric acid secretion
    117799706
  09156 Nervous system
   04728 Dopaminergic synapse
    117799706
   04720 Long-term potentiation
    117799706
   04722 Neurotrophin signaling pathway
    117799706
  09157 Sensory system
   04744 Phototransduction
    117799706
   04740 Olfactory transduction
    117799706
   04750 Inflammatory mediator regulation of TRP channels
    117799706
  09159 Environmental adaptation
   04713 Circadian entrainment
    117799706
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117799706
  09162 Cancer: specific types
   05214 Glioma
    117799706
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    117799706
   05163 Human cytomegalovirus infection
    117799706
   05167 Kaposi sarcoma-associated herpesvirus infection
    117799706
  09171 Infectious disease: bacterial
   05133 Pertussis
    117799706
   05152 Tuberculosis
    117799706
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117799706
   05012 Parkinson disease
    117799706
   05022 Pathways of neurodegeneration - multiple diseases
    117799706
  09165 Substance dependence
   05031 Amphetamine addiction
    117799706
   05034 Alcoholism
    117799706
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117799706
   05418 Fluid shear stress and atherosclerosis
    117799706
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    117799706
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    117799706
   03036 Chromosome and associated proteins [BR:aml03036]
    117799706
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    117799706
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     117799706
Membrane trafficking [BR:aml04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    117799706
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     117799706
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   117799706
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen Caleosin TerB DUF1103 Poly_export DUF5580_M SurA_N_2 PhageMin_Tail SurA_N_3 PA_Ig-like MecA_N
Other DBs
NCBI-GeneID: 117799706
NCBI-ProteinID: XP_034508097
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQIGEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDKDGNGYISSAELRHVMTNLGEKLTDE
EVDEMIREADVDGDGQVNYEEFVQMMTSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcagaccaactgacagaggagcagatcggtgagttcaaggaggcattctcactcttt
gacaaagatggtgatggcaccattactactaaggagctgggtactgtcatgaggtcgctg
ggccagaacccgaccgaggctgagctgcaggacatgataaatgaggtggatgctgatggt
aatggaaccattgactttccagagttccttaccatgatggcaaggaagatgaaggacaca
gacagtgaggaagaaatccgggaagccttcaaagtgttcgataaggatggcaatggttat
atcagctcggctgagcttcgtcacgtgatgaccaatctgggcgaaaagctaacagacgag
gaggtggacgagatgatacgagaagcagatgtcgatggagacggacaggtcaactatgaa
gagtttgtacagatgatgacttcaaagtaa

DBGET integrated database retrieval system