Ailuropoda melanoleuca (giant panda): 117802187 Help Entry 117802187         CDS       T01329                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04613   Neutrophil extracellular trap formation aml05034   Alcoholism aml05202   Transcriptional misregulation in cancer aml05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     117802187  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     117802187   09163 Immune disease    05322 Systemic lupus erythematosus     117802187   09165 Substance dependence    05034 Alcoholism     117802187  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     117802187   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     117802187 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     117802187 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117802187 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  117802187 NCBI-ProteinID:  XP_034516004 LinkDB All DBs Position 5:complement(2230352..2230824) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacaaagcagacggcgcgcaagtcgaccggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system