Ailuropoda melanoleuca (giant panda): 117802190 Help Entry 117802190         CDS       T01329                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04613   Neutrophil extracellular trap formation aml05034   Alcoholism aml05203   Viral carcinogenesis aml05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     117802190  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     117802190   09163 Immune disease    05322 Systemic lupus erythematosus     117802190   09165 Substance dependence    05034 Alcoholism     117802190  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     117802190 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     117802190 SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  117802190 NCBI-ProteinID:  XP_034516022 Ensembl:  ENSAMEG00000024800 LinkDB All DBs Position 5 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcggcaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcactctctacggc ttcgggggctga

DBGET integrated database retrieval system