Amycolatopsis mediterranei S699: AMES_4551 Help Entry AMES_4551         CDS       T02190                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amm  Amycolatopsis mediterranei S699 Pathway amm00998   Biosynthesis of various antibiotics amm01100   Metabolic pathways amm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMES_4551 (acpP)    00074 Mycolic acid biosynthesis     AMES_4551 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMES_4551 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFO78087 UniProt:  A0A9R0U9Y4 LinkDB All DBs Position 5089182..5089487 Genome browser AA seq 101 aa AA seqDB search MSIETTTANEVTVLAQLGGMLRELLEEYGLDDTEITMDTTFHDDLELESVDLVALSGQLR EHYGDRVNFATFIAERDLEEIIALTVGELVRYIVASLRATA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagcatcgagaccacgaccgcgaacgaggtgaccgtgctcgcccagctcggcgggatg ctgcgggaactgctcgaggagtacggcctcgacgacaccgagatcaccatggacacgacg ttccacgacgacctcgaactggagagcgtcgacctggtggcgctgtccgggcagctgcgc gagcactacggcgaccgcgtcaacttcgcgaccttcatcgccgagcgcgacctggaggag atcatcgcgctgacggtcggcgagctcgtgcggtacatcgtcgcctccctgcgggcgacc gcgtga

DBGET integrated database retrieval system