Amycolatopsis mediterranei S699: RAM_10675 Help Entry RAM_10675         CDS       T01822                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amn  Amycolatopsis mediterranei S699 Pathway amn00998   Biosynthesis of various antibiotics amn01100   Metabolic pathways amn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RAM_10675 (acpP)    00074 Mycolic acid biosynthesis     RAM_10675 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RAM_10675 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AEK40625 UniProt:  A0A9R0NU02 LinkDB All DBs Position complement(2244069..2244314) Genome browser AA seq 81 aa AA seqDB search MADNAEILAGLAEIVEEVAGVAQDDVTAEKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DELANLKTVGDAVNYVSANSK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgacaacgctgagatcctcgccggcctcgccgagatcgtcgaagaggtcgccggt gtggctcaggacgacgtcaccgccgagaagtcgttcgtggacgacctggacatcgactcg ctgtcgatggtcgagatcgccgtgcaggccgaggacaagttcggcgtcaagatcccggac gacgagctcgccaacctcaagaccgtgggcgacgcggtgaactacgtgtcggccaactcg aagtaa

DBGET integrated database retrieval system