Amycolatopsis mediterranei S699: RAM_20425 Help Entry RAM_20425         CDS       T01822                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amn  Amycolatopsis mediterranei S699 Pathway amn00998   Biosynthesis of various antibiotics amn01100   Metabolic pathways amn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RAM_20425    00074 Mycolic acid biosynthesis     RAM_20425   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RAM_20425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AEK42565 UniProt:  A0A9R0NXW5 LinkDB All DBs Position 4377582..4377839 Genome browser AA seq 85 aa AA seqDB search MSPSDDVERTLVQLIAKVSGTDPVALSAGRPLTGLSLRDELDIDSLAMVELTDEIENNYG LTIPEDGLHRLQTFGDVADYLRAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgagcccttcggacgacgtcgagcgcaccctggtccagctgatcgcgaaggtgtccggc accgacccggtggcgctgtccgccggccgcccgctgaccgggctgtcgctgcgcgacgaa ctggacatcgactcgctggccatggtcgagctgaccgacgagatcgagaacaactacggc ctgacgatccccgaggacggcctgcaccggctgcagaccttcggcgacgtcgccgactac ctgcgcgccgcggcgtga

DBGET integrated database retrieval system