Amycolatopsis mediterranei S699: RAM_21290 Help Entry RAM_21290         CDS       T01822                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amn  Amycolatopsis mediterranei S699 Pathway amn00998   Biosynthesis of various antibiotics amn01100   Metabolic pathways amn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RAM_21290    00074 Mycolic acid biosynthesis     RAM_21290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RAM_21290 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEK42738 UniProt:  A0A9R0NY07 LinkDB All DBs Position 4592499..4592774 Genome browser AA seq 91 aa AA seqDB search MVATVGDHRAEVTKVVCDTFRLDPALVEPDAPLEELGIDSKGRIKLLAALEIYYGVTIDL DRLDRFTDVGSVAGVLAEALGTRGSSGEALK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggtggcgaccgtgggtgatcaccgcgccgaggtcacgaaggtcgtctgcgacaccttc cggctcgacccggctctcgtcgagcccgacgcgcccctggaggagctgggcatcgactcg aaggggcggatcaagctgctggcggcgctggagatctattacggggtgacgatcgacctg gaccggctggaccggttcaccgacgtgggatccgtggccggggtgctcgcggaagcactg ggaactcgaggatcttcaggagaggcgctgaaatga

DBGET integrated database retrieval system