Amycolatopsis mediterranei S699: RAM_23450 Help Entry RAM_23450         CDS       T01822                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism amn  Amycolatopsis mediterranei S699 Pathway amn00998   Biosynthesis of various antibiotics amn01100   Metabolic pathways amn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:amn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RAM_23450    00074 Mycolic acid biosynthesis     RAM_23450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RAM_23450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEK43170 UniProt:  A0A9R0U9Y4 LinkDB All DBs Position 5079994..5080299 Genome browser AA seq 101 aa AA seqDB search MSIETTTANEVTVLAQLGGMLRELLEEYGLDDTEITMDTTFHDDLELESVDLVALSGQLR EHYGDRVNFATFIAERDLEEIIALTVGELVRYIVASLRATA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagcatcgagaccacgaccgcgaacgaggtgaccgtgctcgcccagctcggcgggatg ctgcgggaactgctcgaggagtacggcctcgacgacaccgagatcaccatggacacgacg ttccacgacgacctcgaactggagagcgtcgacctggtggcgctgtccgggcagctgcgc gagcactacggcgaccgcgtcaacttcgcgaccttcatcgccgagcgcgacctggaggag atcatcgcgctgacggtcggcgagctcgtgcggtacatcgtcgcctccctgcgggcgacc gcgtga

DBGET integrated database retrieval system