Acetomicrobium mobile: Anamo_0277
Help
Entry
Anamo_0277 CDS
T02151
Name
(GenBank) response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
amo
Acetomicrobium mobile
Pathway
amo02020
Two-component system
amo02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
amo00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
Anamo_0277
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
Anamo_0277
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
amo02022
]
Anamo_0277
02035 Bacterial motility proteins [BR:
amo02035
]
Anamo_0277
Two-component system [BR:
amo02022
]
CheA family
CheA-CheYBV (chemotaxis)
Anamo_0277
Bacterial motility proteins [BR:
amo02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
Anamo_0277
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
B12-binding
Motif
Other DBs
NCBI-ProteinID:
AFM20937
UniProt:
I4BUI0
LinkDB
All DBs
Position
266897..267259
Genome browser
AA seq
120 aa
AA seq
DB search
MPKVLIVDDAAFMRMMLKDILVKNGYEIAGEVSNGVEAVAAYRESKPDIVTMDITMPEMD
GITAVKEIKKIDPNAKIVMVSAMGQQALVIEAIKAGALDFIVKPFQPDRVLQALEKALSQ
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
gtgcctaaggtgcttattgttgacgatgcggccttcatgagaatgatgttaaaggacatt
ttggtaaaaaatgggtatgagatcgccggagaggtatccaatggcgtagaggctgttgcc
gcctatagggaatccaaacctgatattgtaactatggatataactatgcccgaaatggac
ggaataacggcagtcaaggagatcaagaagatagatcctaacgccaagatcgtgatggta
agcgctatgggccaacaggcattggtcatagaagctatcaaagctggagctttggatttt
atagtaaagccttttcagcctgatagggttttgcaggctttggagaaggctttatctcaa
tag
DBGET
integrated database retrieval system