Acetomicrobium mobile: Anamo_1430 Help Entry Anamo_1430        CDS       T02151                                  Name (GenBank) SOS response UmuD protein   KO K03503   DNA polymerase V [EC:3.4.21.-] Organism amo  Acetomicrobium mobile Brite KEGG Orthology (KO) [BR:amo00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:amo01002]     Anamo_1430   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:amo03400]     Anamo_1430 Peptidases and inhibitors [BR:amo01002]  Serine peptidases   Family S24: LexA family    Anamo_1430 DNA repair and recombination proteins [BR:amo03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Y-family DNA polymerases     Anamo_1430 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_S24 Motif Other DBs NCBI-ProteinID:  AFM22034 UniProt:  I4BXM7 LinkDB All DBs Position 1418775..1419110 Genome browser AA seq 111 aa AA seqDB search MGRFNTTTGFPTPAAEKAHSLDLNELIIYNRASTYFLRASGDCLKLGICNGDILVIDRSL NPCDGDIAVVVKDDSLQLKEIIPSEVIHPNFSDEWQERFFGIVTWVIHKAK NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgggtcgtttcaacaccaccacaggttttccgacgcccgcagcagaaaaggctcactcc ttggatttaaacgaattgatcatatacaaccgcgcttcaacatatttcttacgtgcctca ggcgattgtctaaagcttggcatctgcaatggcgatatcttagtgatagatcgatcgtta aacccctgtgatggcgacatcgcagtggtagttaaggatgactcgttacagctcaaagaa attataccatccgaagtcatacaccccaatttttccgatgagtggcaagagcgctttttc ggtatcgtaacgtgggtaatccacaaagctaaatga

DBGET integrated database retrieval system